PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016488243.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 177aa    MW: 20266 Da    PI: 9.3889
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016488243.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF391e-121661247
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
                    +ie k     tfskRr+g+ KKA+EL   C++++ +++ s+tgk +
  XP_016488243.1 16 KIEKKDDLFATFSKRRAGLYKKASELIAECGVDIGIVVSSPTGKPF 61
                    6777777789*********************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006619.75767IPR002100Transcription factor, MADS-box
SMARTSM004326.4E-18766IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.19E-21877IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-11929IPR002100Transcription factor, MADS-box
PfamPF003191.3E-181663IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-112944IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-114465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MVNKKTKGRQ KIQMKKIEKK DDLFATFSKR RAGLYKKASE LIAECGVDIG IVVSSPTGKP  60
FSFFHPTEDA IIARFQNPDM QLSQTTGLVA AHARNKVNYL NSRLEELDTR EDAATAQTRF  120
YDKMTETRES GWWESIEQLN VDEVTKFETW LKTVVFNMNN RLNQLEIGAS SSTPNYF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016488243.11e-131PREDICTED: agamous-like MADS-box protein AGL29
TrEMBLK4BSX14e-78K4BSX1_SOLLC; Uncharacterized protein
STRINGSolyc04g056740.1.11e-77(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38220138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36590.12e-29M-type_MADS family protein